Day: oktober 14, 2015

Ecto Motif Ryu

Teman jag nu testar/testat. Just nu har jag fixat till Ryu. Undrar hur länge jag ”står ut med” detta innan jag känner behov av något nytt?

Lugn dag – mest hemma. Bloggfixande tar tid. Det regnar ute. Har varmt på mig inne. Badade varmt – riktigt varmt. Skönt!

Njuter nu av getost, oliver och ett glas ungerskt vin.

Ungersk getost

En dag som idag & #haiku

… är jag lite avslagen efter gårdagens eviga väntan och sena natt. Men jag har ändå haft en mysig stund och ätit lunch ute med min syster. Badat och njutit i varmt vatten. Druckit en extra kopp Zoégas kaffe. Bloggat (förstås!). Lyssnat på #pldebatt i Riksdagen. Tvättat lite.

Det regnar ute.
Stillheten ligger inne.
Väderväxling känns.

Så blev det en #haiku 5-7-5. Faktiskt ganska kul att skriva. Men mestadels lägger jag dem i min Photo & Poetry. Överhuvudtaget är det roligt att skriva.

Igår testade jag olika blogteman. Det kommer jag säkert att göra idag också. Det tar tid men jag vill ha ett tema ja kan känna mig helnöjd med. Jag gillar inte formatet eller placeringen av ”featured picture” i detta temat!

Blue fence

suck ‘n sigh

Mellan klockan 20 och 21 visade sig bli lite senare. Hungrig och trött. Kortsluten i huvudet av alla varmvattenberedarfunktionerochbevakningarsamtregleringaravtrycketförattvridapåknappenrätt!
Klockan 23:50 lämnade servicekillen efter pratsamt jobb.

Jag var totalt slut. Getosten väntade ju och vinet korkades till slut snabbt upp. Oliverna smakade sagolikt. *suck ‘n sigh*

Nåja lite gnista hade jag tydligen kvar. Inspirerad av Aktuellts (stavas Aktuellt med 1 eller 2 l ?) Ibland tror jag jag har blivit miljöskadad av allt speciallärarjobb – kan man få läs-och skrivsvårigheter genom att ha jobbat många år inom detta område? *suck ‘n sigh*
Läs Jan Edlings rapport! Sverige borde skämmas! Integrationen är totalmisslyckad! Bara att konstatera! Punkt slut!

Men – ändå – trots allt – vilket underbart land vi har – man kan skriva – och tycka – precis vad man vill – utan att fängslas – I love! – I do! – YES!

Vackra ord skapar ingen gynnsam integration!